Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

WH0003576M5

Sigma-Aldrich

Monoclonal Anti-IL8 antibody produced in mouse

clone 6G4, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-CXCL8, Anti-GCP1, Anti-Interleukin 8, Anti-K60, Anti-NAP1, Anti-SCYB8, Anti-TSG1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

6G4, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IL8(3576)

Description générale

Interleukin-8 (IL-8)/CXCL8 is an important chemoattractant cytokine and activator of neutrophils. It is liberated from endothelial cells, gingival fibroblasts, neutrophils, monocytes and phagocytes in the gingival crevice. IL-8 belongs to the CXC subfamily. This gene is located on human chromosome 4q13.3.
The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. (provided by RefSeq)

Immunogène

IL8 (AAH13615.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Actions biochimiques/physiologiques

Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.
Interleukin-8 (IL-8)/CXCL8 participates in the progression of peripheral muscle weakness in individuals with COPD (chronic obstructive pulmonary disease). It helps in the transport of neutrophils across endothelium, pulmonary epithelium and fibroblasts. CXCL8 induces adhesion of neutrophils to extracellular matrix proteins and cytokine-stimulated endothelial monolayers via interaction with CD11b/CD18 (β2-integrins).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Association between interleukin-8 levels and chronic periodontal disease: A PRISMA-compliant systematic review and meta-analysis
Finoti LS, et al.
Medicine, 96(22) (2017)
Pathophysiological roles of interleukin-8/CXCL8 in pulmonary diseases
Mukaida N.
American Journal of Physiology. Lung Cellular and Molecular Physiology, 284(4), L566-L577 (2003)
Muscle force during an acute exacerbation in hospitalised patients with COPD and its relationship with CXCL8 and IGF-I
Spruit MA, et al.
Thorax, 58(9), 752-756 (2003)
Label-free electrochemical impedance biosensor to detect human interleukin-8 in serum with sub-pg/ml sensitivity.
Sharma R
Biosensors And Bioelectronics, 80, 607-613 (2016)
Prem Raj B Joseph et al.
The Biochemical journal, 472(1), 121-133 (2015-09-16)
Chemokine CXCL8/interleukin-8 (IL-8) plays a crucial role in directing neutrophils and oligodendrocytes to combat infection/injury and tumour cells in metastasis development. CXCL8 exists as monomers and dimers and interaction of both forms with glycosaminoglycans (GAGs) mediate these diverse cellular processes.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique