SAB5702904

Anti-PLTP Antibody, clone 6A1Q1, Rabbit Monoclonal

• Synonyme(s) : BPIFE, HDLCQ9
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46
• Clone: 6A1Q1, monoclonal
• application: IHC; WB
• Espèces réactives: rat, rat, human
• Technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 6A1Q1, monoclonal
• Forme: liquid
• Poids mol.: 80 kDa
• Espèces réactives: rat, rat, human
• Concentration: 1.53 mg/mL
• Technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: LDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLD
• Numéro d'accès UniProt: P55058
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PLTP(5360)

Description

Description générale

The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PLTP (P55058).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1