SAB5702869

Anti-HLTF Antibody, clone 8T0I2, Rabbit Monoclonal

• Synonyme(s) : HIP116, HIP116A, HLTF1, RNF80, SMARCA3, SNF2L3, ZBU1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46
• Clone: 8T0I2, monoclonal
• application: WB
• Espèces réactives: rat, human, rat
• Technique(s): western blot: 1:500 - 1:2000

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 8T0I2, monoclonal
• Forme: liquid
• Poids mol.: 114 kDa
• Espèces réactives: rat, human, rat
• Concentration: 1.04 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: TEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
• Numéro d'accès UniProt: Q14527
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... HLTF(6596)

Description

Description générale

This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein. [provided by RefSeq, Jul 2008]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 900-1009 of human HLTF (Q14527).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1