SAB5702684

Anti-RPL13 Antibody, clone 7W3W9, Rabbit Monoclonal

• Synonyme(s) : RPL13, BBC1, D16S444E, D16S44E, L13, ribosomal protein L13
• Code UNSPSC : 12352203

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 7W3W9, monoclonal
• Forme: liquid
• Poids mol.: 24 kDa
• Espèces réactives: human, rat, rat
• Concentration: 0.80 mg/mL
• Technique(s): immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDP
• Numéro d'accès UniProt: P26373
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... RPL13(6137)

Description

Description générale

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL13 (P26373).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC, IF/ICC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1