SAB5702598

Anti-FGF7/KGF Antibody, clone 4L2O8, Rabbit Monoclonal

• Synonyme(s) : HBGF-7, KGF
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 4L2O8, monoclonal
• Forme: liquid
• Poids mol.: 28 kDa
• Espèces réactives: rat, rat, human
• Concentration: 1.50 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEI
• Numéro d'accès UniProt: P21781
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FGF7(2252)

Description

Description générale

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq, Jul 2008]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF7/FGF7/KGF (P21781).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1