SAB5702279

Anti-Integrin alpha 6 (ITGA6/CD49f) Antibody, clone 7U5Z0, Rabbit Monoclonal

• Synonyme(s) : CD49f,ITGA6B,VLA-6,Integrin alpha 6,ITGA6
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 7U5Z0, monoclonal
• Forme: liquid
• Poids mol.: 125 kDa
• Espèces réactives: rat, rat, human
• Concentration: 1 mg/mL
• Technique(s): western blot: 1:500 - 1:1000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP
• Numéro d'accès UniProt: P23229
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ITGA6(3655)

Description

Description générale

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants.

Immunogène

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 481-591 of human Integrin alpha 6 (ITGA6/CD49f) (NP_001073286.1).

Application

WB

Informations sur la sécurité

• Pictogrammes: GHS07,GHS09
• Mention d'avertissement: Warning
• Mentions de danger: H317,H411
• Conseils de prudence: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classification des risques: Aquatic Chronic 2 - Skin Sens. 1
• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3