SAB2102776

Anti-ZFYVE1 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-DFCP1, Anti-KIAA1589, Anti-TAFF1, Anti-ZNFN2A1, Anti-Zinc finger, FYVE domain containing 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 87 kDa
• Espèces réactives: dog, human, guinea pig, horse, mouse, rat, rabbit, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès UniProt: Q9HBF4
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ZFYVE1(53349)

Description

Description générale

Zinc finger FYVE-type containing 1 (ZFYVE1) encodes a 777 amino acid protein, which consists a N terminal Cys-His cluster homologous to zinc finger domains and two zinc-binding FYVE domains at the C terminal. It also contains an ATP/GTP binding site. ZFYVE1 gene is located on human chromosome 14q22-q24.

Immunogène

Synthetic peptide directed towards the C terminal region of human ZFYVE1

Actions biochimiques/physiologiques

ZFYVE1 contains two zinc-binding FYVE domains in tandem. This protein binds to phosphatidylinositol-3-phosphate (PtdIns3P) through its FYVE-type zinc finger. It displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes.The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains two zinc-binding FYVE domains in tandem. This protein displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes. Zinc finger FYVE-type containing 1 (ZFYVE1) organizes the endoplasmic reticulum around the phagophore to form a cradle like structure, which is called as an omegasome.

Séquence

Synthetic peptide located within the following region: VCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable