Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

SAB1412433

Sigma-Aldrich

ANTI-MUC2 antibody produced in mouse

clone 1H2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

MLP, MUC2, SMUC

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1H2, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen 36.63 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable

Isotype

IgG2bκ

Numéro d'accès NCBI

NM_002457

Numéro d'accès UniProt

Q02817

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MUC2(4583)

Description générale

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (provided by RefSeq)

Immunogène

MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Tsukasa Nishida et al.
Diseases of the colon and rectum, 57(8), 905-915 (2014-07-09)
The appropriateness of endoscopic resection in patients with T1 colorectal carcinomas is unclear. Highly precise predictors of lymph node metastasis are required to optimize the outcomes of treatments for T1 colorectal carcinomas. The purpose of this work was to identify
Takanori Yamada et al.
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association, 70, 107-113 (2014-05-20)
Helicobacter pylori (H. pylori) infection is well known to be associated with chronic gastritis and also development of gastric cancer. Raphanobrassica (RB) is an intergeneric hybrid of the genera Raphanus (radish) and Brassica (cabbages) containing appreciable amounts of glucoraphanin (GR)
Øystein Sørdal et al.
Experimental and molecular pathology, 96(3), 274-278 (2014-03-05)
The purpose of this study is to assess the exocrine and neuroendocrine properties of tumour cells in diffuse gastric cancer with signet ring cell differentiation. Mucin mRNA and protein expressions (MUC1, 2, 3, 4, 5AC, 6 and MUC13) were assessed
Stéphanie Da Silva et al.
American journal of physiology. Gastrointestinal and liver physiology, 307(4), G420-G429 (2014-06-28)
Despite well-known intestinal epithelial barrier impairment and visceral hypersensitivity in irritable bowel syndrome (IBS) patients and IBS-like models, structural and physical changes in the mucus layer remain poorly understood. Using a water avoidance stress (WAS) model, we aimed at evaluating

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique