SAB1410844

Anti-NNMT antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen 29.6 kDa
• Espèces réactives: human, mouse
• Technique(s): western blot: 1 μg/mL
• Numéro d'accès NCBI: NM_006169.2
• Numéro d'accès UniProt: P40261
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NNMT(4837)

Description

Description générale

The nicotinamide N-methyltransferase (NNMT) gene, spanning 16.5kb of genomic DNA with three exons and two introns, is mapped to human chromosome 11q23.1. The encoded protein consists of 264 amino acids with a predicted molecular mass of 29.6kDa. NNMT is expressed in cytoplasm.

Immunogène

NNMT (NP_006160.1, 1 a.a. ~ 264 a.a) full-length human protein.

Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Actions biochimiques/physiologiques

Nicotinamide N-methyltransferase (NNMT) is a cytosolic methyltransferase enzyme. It catalyzes the N-methylation of nicotinamide, pyridines and other structural analogs. Hence, it plays a vital role in the biotransformation and detoxification of various xenobiotic compounds. Altered expression of the gene is associated with the pathogenesis of various diseases such as acute lymphoblastic leukemia (ALL), parkinson′s disease, thyroid cancer, gastric cancer, colorectal cancer, lung, liver and oral carcinomas. In addition, variation in the gene might increase the risk of susceptibility to hyperlipidemia and migraine.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable