Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

SAB1410147

Sigma-Aldrich

Anti-RAB32 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen 24.75 kDa

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RAB32(10981)

Description générale

Small GTP-binding proteins of the RAB family, such as RAB32, play essential roles in vesicle and granule targeting (Bao et al., 2002 [PubMed 11784320]).[supplied by OMIM

Immunogène

RAB32 (NP_006825.1, 1 a.a. ~ 225 a.a) full-length human protein.

Sequence
MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC

Actions biochimiques/physiologiques

RAB32 (Ras-related protein) controls intracellular lipid accumulation in hepatocytes. Absence of it promotes the expression of ATGL (adipose triglyceride lipase) and thereby causes lipolysis. RAB32 is involved in hepatic steatosis. In melanogenesis, it is involved in the transport of important enzymes, such as tyrosinase and Tyrp1 (tyrosinase related protein 1). RAB32 also interacts with and is involved in localization of leucine-rich repeat kinase 2 (LRRK2), a protein associated with Parkinson′s disease. RAB32 is hypermethylated in microsatellite-unstable colon, gastric and endometrial adenocarcinomas.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

BLOC-3 mutated in Hermansky-Pudlak syndrome is a Rab32/38 guanine nucleotide exchange factor.
Gerondopoulos A
Current Biology, 22, 2135-2139 (2012)
Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
Seto S
Traffic, 12, 407-420 (2011)
Altered gene expression in the superior temporal gyrus in schizophrenia.
Bowden NA
BMC Genomics, 9, 199-199 (2008)
RAB32 hypermethylation and microsatellite instability in gastric and endometrial adenocarcinomas.
Shibata D
International Journal of Cancer. Journal International Du Cancer, 119, 801-806 (2006)
LRRK2 transport is regulated by its novel interacting partner Rab32.
Waschbusch D
PLoS ONE, 9, e111632-e111632 (2014)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique