SAB1404343

Monoclonal Anti-RXRG, (N-terminal) antibody produced in mouse

clone 1B2, ascites fluid

• Synonyme(s) : NR2B3, RXRC
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: ascites fluid
• Type de produit anticorps: primary antibodies
• Clone: 1B2, monoclonal
• Poids mol.: antigen ~29.63 kDa
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable
• Isotype: IgMκ
• Numéro d'accès NCBI: NM_001009598
• Numéro d'accès UniProt: P48443
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... RXRG(6258)

Description

Description générale

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Immunogène

RXRG (-, 1 a.a. ~ 33 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLG

Forme physique

Clear solution

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable