Accéder au contenu
Merck
Toutes les photos(4)

Key Documents

SAB1403322

Sigma-Aldrich

Monoclonal Anti-KIAA1199 antibody produced in mouse

clone 3C12, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

TMEM2L

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(4)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3C12, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~37.11 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

NM_018689

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... KIAA1199(57214)

Description générale

KIAA1199 is an endonuclear protein secreted into the extracellular environment. It encodes a 150kDa, inner ear-specific protein consisting of three domains and an N-terminal secretion signal. It is expressed in the inner ear.
Mouse monoclonal antibody raised against a partial recombinant KIAA1199.

Immunogène

KIAA1199 (NP_061159.1, 880 a.a. ~ 979 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW

Application

Monoclonal Anti-KIAA1199 antibody produced in mouse is suitable for capture ELISA, indirect ELISA and western blot applications.

Actions biochimiques/physiologiques

KIAA1199 performs in cell signaling, adhesion, migration and proliferation in human cancers. In colon cancer, it is highly expressed in several cells including cytoplasm, perinuclear space and the cell membrane of adenocarcinomas and cochlea. It mediates hyaluronan (HA) depolymerization in an acidic cellular microenvironment such as clathrin-coated vesicles or early endosomes. In addition, it is also associated with the protein binding, transport, and folding; and Ca2+, G-protein, ephrin, and Wnt signaling. It has been reported that KIAA1199 may negatively regulate the Wnt/CTNNB1 signaling pathway.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Yongsheng Zhang et al.
Oncology reports, 31(4), 1503-1508 (2014-02-28)
KIAA1199 is a gene included in the Human Unidentified Gene-Encoded (HUGE) large protein database which contains more than 2,400 members identified in the Kazusa cDNA sequencing project. Early studies described KIAA1199 as an inner ear-specific protein in which 3 point
Hiroyuki Yoshida et al.
FEBS letters, 588(1), 111-116 (2013-11-26)
Recently, we disclosed that KIAA1199-mediated hyaluronan (HA) depolymerization requires an acidic cellular microenvironment (e.g. clathrin-coated vesicles or early endosomes), but no information about the structural basis underlying the cellular targeting and functional modification of KIAA1199 was available. Here, we show

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique