SAB1400666
Monoclonal Anti-CIDEC antibody produced in mouse
clone 2E2, purified immunoglobulin, buffered aqueous solution
Synonyme(s) :
Anti-CIDE-3, Anti-FLJ20871, Anti-Fsp27
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
mouse
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
2E2, monoclonal
Forme
buffered aqueous solution
Espèces réactives
human
Technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
Isotype
IgG1κ
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... CIDEC(63924)
Description générale
CIDEC (cell death inducing DFFA (DNA fragmentation factor subunit α) like effector c) is mapped to human chromosome 3p25.3. The gene codes for FSP27 (fat-specific protein 27), also known as CIDEC. The encoded protein is localized to the lipid droplets surface. The gene is predominantly expressed in white adipose tissues and also expressed in liver and kidney.
Immunogène
CIDEC (NP_071377.2, 53 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
Sequence
SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
Actions biochimiques/physiologiques
CIDEC (cell death inducing DFFA (DNA fragmentation factor subunit α) like effector c) might be responsible for adipocytes differentiation. It is involved in the regulation of lipid droplet morphology and controls the lipid droplets size by inhibiting lipolysis. It is responsible for the triglycerides buildup in adipocytes. Upregulation of the gene is observed in obesity. Overexpression of the gene decreases the fatty acid oxidation (FAO) rate.
Cell death-inducing DFFA-like effector protein C (CIDEC) has a role in the differentiation of adipocytes. It associates with 5′ adenosine monophosphate-activated protein kinase (AMPK) α subunit 1 and acts as a negative regulator of the AMPK complex. CIDEC is also involved in lipid storage and it modulates the size of lipid droplets. The protein has been linked to obesity.
Forme physique
Solution in phosphate buffered saline, pH 7.4
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Bilal Haider Shamsi et al.
PloS one, 9(9), e106992-e106992 (2014-09-12)
Obesity is a metabolic disorder that can lead to high blood pressure, increased blood cholesterol and triglycerides, insulin resistance, and diabetes mellitus. The aim was to study the effects of pioglitazone mediated sensitization of peroxisome proliferator-activated receptor gamma (PPAR-γ) on
Ming Yu et al.
Molecular and cellular biochemistry, 378(1-2), 145-151 (2013-03-12)
Clear cell renal cell carcinoma (ccRCC) is the major and aggressive subtype of renal cell carcinoma. It is known to derive its histologic appearance from accumulation of abundant lipids and glycogens. The cell death-inducing DFF45-like effector (CIDE) family has been
Ming-Jiang Xu et al.
Gastroenterology, 149(4), 1030-1041 (2015-06-24)
Alcoholic steatohepatitis (ASH) is the progressive form of alcoholic liver disease and may lead to cirrhosis and hepatocellular carcinoma. We studied mouse models and human tissues to identify molecules associated with ASH progression and focused on the mouse fat-specific protein
Frederic Reinier et al.
Metabolism: clinical and experimental, 64(11), 1530-1540 (2015-09-10)
Lipodystrophies are a large heterogeneous group of genetic or acquired disorders characterized by generalized or partial fat loss, usually associated with metabolic complications such as diabetes mellitus, hypertriglyceridemia and hepatic steatosis. Many efforts have been made in the last years
Anna Vilà-Brau et al.
Journal of lipid research, 54(3), 592-601 (2012-12-12)
FSP27 [cell death-inducing DFFA-like effector c (CIDEC) in humans] is a protein associated with lipid droplets that downregulates the fatty acid oxidation (FAO) rate when it is overexpressed. However, little is known about its physiological role in liver. Here, we
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique