Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

MSST0015

Sigma-Aldrich

SILuProt B2M beta-2-microglobulin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled

Synonyme(s) :

β-2-microglobulin

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12

Source biologique

human

Niveau de qualité

Produit recombinant

expressed in HEK 293 cells

Essai

≥98% (SDS-PAGE)

Forme

lyophilized powder

Puissance

≥98% Heavy amino acids incorporation efficiency by MS

Technique(s)

mass spectrometry (MS): suitable

Adéquation

suitable for mass spectrometry (standard)

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

human ... B2M(567)

Description générale

SILu Prot B2M is a recombinant, stable isotope-labeled human B2M which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of B2M in mass-spectrometry. SILu Prot B2M is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Actions biochimiques/physiologiques

B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).

Séquence

IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique