MSST0014
SILu™Lite AMBP Alpha-1 Microglycoprotein human
recombinant, expressed in HEK 293 cells, MS protein standard
Synonyme(s) :
Alpha-1-microglobulin, Complex-forming glycoprotein heterogeneous in charge
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12
Produits recommandés
Source biologique
human
Niveau de qualité
Produit recombinant
expressed in HEK 293 cells
Étiquette/Marqueur
His tagged
Pureté
≥98% (SDS-PAGE)
Forme
lyophilized powder
Technique(s)
mass spectrometry (MS): suitable
Adéquation
suitable for mass spectrometry (internal calibrator)
Numéro d'accès UniProt
Température de stockage
−20°C
Informations sur le gène
human ... AMBP(259)
Catégories apparentées
Description générale
SILu™ Lite AMBP is a recombinant human protein expressed in human 293 cells. It is a monomer of 204 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~23 kDa. SILu™ Lite AMBP is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Actions biochimiques/physiologiques
AMBP is synthesized by the liver. Approximately half of the circulating protein is complexed to IgA. The free form of AMBP is filtered by the glomerulus and reabsorbed by proximal tubule cells. AMBP has been found to be a sensitive biomarker for proximal tubular dysfunction even in the early phase of injury when no histologic damage is observable. In addition, urinary AMBP has been proposed to be a useful marker of tubular dysfunction even in low-gestational-age preterm infants, a population at high risk for AKI (Acute Kidney Injury). Urinary AMBP is also a marker of kidney damage in type 2 diabetes.
Séquence
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVDYKDDDDKGHHHHHHHHGGQ
Forme physique
Supplied as a lyophilized powder containing phosphate buffered saline.
Informations légales
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
Code de la classe de stockage
11 - Combustible Solids
Classe de danger pour l'eau (WGK)
WGK 2
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Elisa Bellei et al.
The journal of headache and pain, 16, 559-559 (2015-08-15)
Medication-overuse headache (MOH) is a chronic disorder that results from the overuse of analgesics drugs, triptans or other acute headache compounds. Although the exact mechanisms underlying MOH remain still unknown, several studies suggest that it may be associated with development
Vishal S Vaidya et al.
Annual review of pharmacology and toxicology, 48, 463-493 (2007-10-17)
Acute kidney injury (AKI) is a common condition with a high risk of death. The standard metrics used to define and monitor the progression of AKI, such as serum creatinine and blood urea nitrogen levels, are insensitive, nonspecific, and change
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique