MSQC4
SILu™Lite SigmaMAb Universal Antibody Standard human
Synonyme(s) :
IgG1 light, Mass Spectrometry Universal Antibody Standard, SILu™Lite SigmaMAb Universal Antibody Standard human, recombinant IgG1 lambda light antibody, SigmaMAb
About This Item
Produits recommandés
Produit recombinant
expressed in CHO cells
Niveau de qualité
Conditions d'expédition
wet ice
Température de stockage
−20°C
Description générale
It consists of two identical heavy chains and two identical light chains. The heavy chains and light chains are linked by one disulfide bond. The heavy chains are linked by two disulfide bonds located in a hinge domain. The other 12 cysteine bonds are intramolecularly restricted to six different globular domains. The antibody sequence has been evaluated by intact mass and peptide mapping using four different enzymes: chymotrypsin, Asp-N and Glu-C endoproteinases and trypsin. Sequence coverage of 100% was obtained.
Application
Caractéristiques et avantages
Description / Composition / Modification / Average Mass (Da)
Light chain, reduced / C1006H1555N267O333S7 / Pyroglutamic acid (Q) / 22942.2
Heavy chain, reduced / C2181H3393N587O663S16 / (no modification) / 48957.8
C2237H3485N591O702S16 / G0F / 50403.2
C2243H3495N591O707S16 / G1F / 50565.3
C2249H3505N591O712S16 / G2F / 50727.5
Native intact mass, non-reduced / C6374H9864N1708O1992S46 / 2 X Pyroglutamic acid (Q) / 143767.7
C6486H10048N1716O2070S46 / G0F+G0F / 146658.4
C6492H10058N1716O2075S46 / G0F+G1F / 146820.6
C6498H10068N1716O2080S46 / G1F+G1F / 146982.7
C6504H10078N1716O2085S46 / G1F+G2F / 147144.8
C6510H10088N1716O2090S46 / G2F+G2F / 147307.0
Forme physique
Notes préparatoires
Remarque sur l'analyse
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS
Autres remarques
Reconstitute the contents of the vial by adding 500μL of ultrapure water or phosphate buffer, and mixing vigorously. The solubilized product can be further diluted as needed.
Informations légales
Produit(s) apparenté(s)
Supplément
Code de la classe de stockage
11 - Combustible Solids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Faites votre choix parmi les versions les plus récentes :
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Les clients ont également consulté
Articles
Residual presence of host cell proteins (HCPs) in recombinant therapeutic products has considerable clinical safety risks associated with a potential immunological response in patients.
Comparative analysis of different columns in resolving medium-sized fragments of monoclonal antibodies, after digestion using dithiothreitol (DTT) or IdeS (a protease), by Reversed-Phase Chromatography.
The use of PNGase Fast denaturing buffer and enzyme yielded results similar to a conventional 20-hour protocol with overnight digest while reducing workflow time to about 1 hour with a 15-minute digest.
Step-by-step workflows for the intact mass analysis, peptide mapping, and N-glycan analysis of the monoclonal antibody― adalimumab, for an accurate characterization of the critical quality attributes (CQAs) to ensure drug safety and efficacy. Read more.
Protocoles
Here we show how LC and MS methods may be optimized using a non-toxic surrogate of the ADC, an “ADC-mimic”, that behaves very similarly to the Cys-linked ADC Adcetris (Seattle Genetics).
SigmaMab Antibody Drug Conjugate Mimic, is a non-toxic drug mimic utilized as a standard for mass spectrometry and high performance liquid chromatography.
BIOshell™ IgG 1000 Å C4 UHPLC Column for Improved Biomacromolecule Separations
Step-by-step SEC-MS protocol for rapid glycoprofiling of a monoclonal antibody (mAb), consisting of antibody purification, a mAb reduction procedure, a mass spectrometer calibration, and a system suitability test.
Contenu apparenté
Step-by-step reversed phase UHPLC-MS workflow for middle-up mass analysis of an immunoglobulin G antibody, consisting of antibody purification, IdeS proteolysis and reduction, mass spectrometer calibration, mAb quantification, and a system suitability test.
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique