Accéder au contenu
Merck
Toutes les photos(5)

Documents

HPA051870

Sigma-Aldrich

Anti-TMEM119 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Tmem119 Antibody, Tmem119 Antibody - Anti-TMEM119 antibody produced in rabbit, Anti-transmembrane protein 119

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(5)

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA051870
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunohistochemistry: 1:500-1:1000

Séquence immunogène

GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS

Numéro d'accès UniProt

Q4V9L6

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TMEM119(338773)

Description générale

Transmembrane protein 119 (TMEM119) is encoded by the gene mapped to human chromosome 12q23.3. The encoded protein belongs to the transmembrane protein family. TMEM119 has an O-glycosylated N-terminal region.

Immunogène

transmembrane protein 119 recombinant protein epitope signature tag (PrEST)

Application

Anti-TMEM119 antibody produced in rabbit has been used in immunohistochemistry.

Actions biochimiques/physiologiques

Transmembrane protein 119 (TMEM119) acts as an osteoinductive factor and facilitates proliferation, migration and invasion of osteosarcoma cells.(28} It is a critical molecule acting downstream of the parathyroid hormone (PTH) and similar to mothers against decapentaplegic-3 (Smad3) signaling pathways in osteoblasts. TMEM119 is considered to be a potential microglial marker that differentiates resident microglia from blood-derived macrophages in the human brain. Mutation in the gene is associated with the development of osteosarcoma.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST85802

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Copy number variation analysis reveals additional variants contributing to endometriosis development.
Mafra F, et al.
Journal of Assisted Reproduction and Genetics, 34(1), 117-124 (2017)
Zhen-Huan Jiang et al.
Experimental & molecular medicine, 49(5), e329-e329 (2017-05-13)
Osteosarcoma is suggested to be caused by genetic and molecular alterations that disrupt osteoblast differentiation. Recent studies have reported that transmembrane protein 119 (TMEM119) contributes to osteoblast differentiation and bone development. However, the level of TMEM119 expression and its roles
Tobias Zrzavy et al.
Brain pathology (Zurich, Switzerland), 28(6), 791-805 (2017-12-10)
Inflammatory mechanisms, involving granulocytes, T-cells, B-cells, macrophages and activated microglia, have been suggested to play a pathogenic role in experimental models of stroke and may be targets for therapeutic intervention. However, knowledge on the inflammatory response in human stroke lesions
Transcriptomic analysis of purified human cortical microglia reveals age-associated changes.
Galatro T F, et al.
Nature Neuroscience, 20(8), 1162-1162 (2017)
Involvement of the osteoinductive factors, Tmem119 and BMP-2, and the ER stress response PERK?eIF2??ATF4 pathway in the commitment of myoblastic into osteoblastic cells.
Tanaka K I, et al.
Calcified Tissue International, 94(4), 454-464 (2014)
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique