HPA042451

Anti-SETD2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Setd2 Antibody, Setd2 Antibody - Anti-SETD2 antibody produced in rabbit, Anti-Flj23184, Anti-Hif-1, Anti-Hypb, Anti-Kiaa1732, Anti-Kmt3a, Anti-Set domain containing 2
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA042451
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA
• Numéro d'accès UniProt: Q9BYW2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SETD2(29072)

Description

Description générale

SET domain containing 2 (SETD2) is a histone methyltransferase gene and is mapped on human chromosome 3p21.31, a region associated with growth arrest of cancer cells.

Immunogène

SET domain containing 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-SETD2 antibody produced in rabbit has been used in immunohistochemistry.

Actions biochimiques/physiologiques

SET domain containing 2 (SETD2) plays a vital role in trimethylation of the histone mark H3K36 (histone 3 lysine 36). Mutation of this tumor suppressor gene (TSG) is associated with the pathogenesis of various cancers including, clear cell renal cell carcinoma (cRCC), breast cancer, lung cancer, acute lymphoblastic leukemia(ALL), and glioma. In addition, SETD2 gene is also involved in the development of Huntington′s disease (HD). SETD2 plays an important role in the transcriptional elongation by maintaining chromatin structure through association with hyperphosphorylated RNA polymerase II (POLR2A). SETD2 interacts with p53 and acts as a tumor suppressor in breast cancer cells. SETD2 is implicated in DNA double-strand break (DSB) exclusion and homologous recombination (HR) repair in human cells. SETD2 in HeLa cells alters nucleosome organization via decreasing the recruitment of the FACT (facilitates chromatin transcription) complex to active genes.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST79513

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable