Accéder au contenu
Merck
Toutes les photos(7)

Principaux documents

HPA036362

Sigma-Aldrich

Anti-LACTB antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-FLJ14902, Anti-Lactamase, β, Anti-MRPL56

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(7)

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA036362
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

mouse, rat, human

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Séquence immunogène

KEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLL

Numéro d'accès UniProt

P83111

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... LACTB(114294)

Description générale

Lactamase beta (LACTB) is a 60kDa mammalian mitochondrial protein. The protein shows sequence similarity to sequence β-lactamases and penicillin binding proteins (PBPs), which occurs in bacteria. It is expressed in skeletal muscle, heart and liver. The gene is located on human chromosome 15q22.2.

Immunogène

lactamase, beta recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

Lactamase beta (LACTB) inhibits the proliferation of breast cancer cells, by modifying the mitochondrial lipid metabolism and differentiation of breast cancer cells. It contributes to intra-mitochondrial membrane organization, modulates complex I of the mitochondrial electron transport chain and controls cellular metabolic processes. This protein might act as a therapeutic target for gliomas. It may function as a tumor suppressor gene.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST78751

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Overexpression of LACTB, a Mitochondrial Protein, that Inhibits Proliferation and Invasion in Glioma Cells.
Li HT, et al.
Oncology Research, 335-342 (2017)
Expression and purification of the mitochondrial serine protease LACTB as an N-terminal GST fusion protein in Escherichia coli
Liobikas J, et al.
Protein Expression and Purification, 45(2), 335-342 (2006)
LACTB-mediated tumour suppression by increased mitochondrial lipid metabolism
Cucchi D and Mauro C
Cell Death and Differentiation, 24, 335-342 (2017)
Genome-wide association study on detailed profiles of smoking behavior and nicotine dependence in a twin sample.
Loukola A
Molecular Psychiatry, 19(5), 615-624 (2014)
LACTB is a tumour suppressor that modulates lipid metabolism and cell state
Keckesova Z, et al.
Nature, 543(7647), 681-681 (2017)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique