Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV54286

Sigma-Aldrich

Anti-EPHX1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-EPHX, Anti-EPOX, Anti-Eoxide hydrolase 1, microsomal (xenobiotic), Anti-MEH

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

53 kDa

Espèces réactives

horse, goat, guinea pig, rat, human, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... EPHX1(2052)

Immunogène

Synthetic peptide directed towards the middle region of human EPHX1

Application

Anti-EPHX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

EPHX1 [Epoxide hydrolase 1, microsomal (xenobiotic)] gene encodes a biotransformation enzyme that metabolizes arene and aliphatic epoxides to more water-soluble trans-dihydrodiol derivatives. It also plays a pivotal role in carcinogen metabolism and facilitates the sodium-dependent uptake of bile acids into hepatocytes. Mutation in EPHX1 gene results in preeclampsia, which causes increased epoxide hydrolase activity or epoxide hydrolase deficiency.

Séquence

Synthetic peptide located within the following region: CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

J Lundbom et al.
Scandinavian journal of thoracic and cardiovascular surgery, 26(3), 187-192 (1992-01-01)
Factors influencing the effect on employment status were investigated in 250 patients (males: females 224:26) who underwent coronary artery bypass surgery between March 1983 and November 1985. The median age at operation was 57.9 (range 36.6-69.4) years and the median
Jaana Laasanen et al.
European journal of human genetics : EJHG, 10(9), 569-573 (2002-08-13)
This study determined whether genetic variability in exons 3 and 4 of the microsomal epoxide hydrolase gene jointly modifies individual preeclampsia risk. The study also determined whether genetic variability in the gene encoding for microsomal epoxide hydrolase (EPHX) contributes to
C Hassett et al.
Human molecular genetics, 3(3), 421-428 (1994-03-01)
Human microsomal epoxide hydrolase (mEH) is a biotransformation enzyme that metabolizes reactive epoxide intermediates to more water-soluble trans-dihydrodiol derivatives. We compared protein-coding sequences from six full-length human mEH DNA clones and assessed potential amino acid variation at seven positions. The

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique