Accéder au contenu
Merck
Toutes les photos(5)

Principaux documents

AV54283

Sigma-Aldrich

Anti-APOE antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-AD2, Anti-Apolipoprotein E, Anti-Apoprotein, Anti-MGC1571

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

34 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... APOE(348)

Description générale

APOE gene encodes for Apolipoprotein E, a main apoprotein of the chylomicron. ApoE is a 299 amino acid containing plasma protein with a molecular weight of 34kDa. It is synthesized primarily in liver and is mapped on to chromosome 19 in a cluster with APOC1 and APOC2.

Immunogène

Synthetic peptide directed towards the N terminal region of human APOE

Application

Anti-APOE antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

ApoE binds to its specific receptor and mediates the transport of lipid and cholesterol, ligands for the low-density lipoprotein (LDL) and very low density lipoprotein (VLDL) receptors, through the bloodstream. It is also involved in repair mechanism against tissue injury. For example, increased amounts of apolipoprotein E are present at peripheral nerve injury and regeneration site. Mutation in APOE gene leads to familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides results in impaired clearance of chylomicron and VLDL remnant.

Séquence

Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

W A Groenewegen et al.
Arteriosclerosis and thrombosis : a journal of vascular biology, 14(11), 1695-1704 (1994-11-01)
We identified the first insertion mutation that specifies an apolipoprotein (apo)B truncation, apoB-70.5, in a father and son with hypobetalipoproteinemia (total and low-density lipoprotein [LDL] cholesterol < 5th percentile, plasma apoB levels approximately one third of normal). The mutation is
R W Mahley
Science (New York, N.Y.), 240(4852), 622-630 (1988-04-29)
Apolipoprotein E is a plasma protein that serves as a ligand for low density lipoprotein receptors and, through its interaction with these receptors, participates in the transport of cholesterol and other lipids among various cells of the body. A mutant
María Solanas-Barca et al.
Atherosclerosis, 222(2), 449-455 (2012-04-07)
Rare mutations in the APOE gene, undetectable with the usual genotyping technique, are responsible for dominant familial dysbetalipoproteinemia (FD) and therefore could be easily misclassified as familial combined hyperlipidemia (FCHL). We aimed to identify APOE mutations associated with dominant combined
Y K Paik et al.
Proceedings of the National Academy of Sciences of the United States of America, 82(10), 3445-3449 (1985-05-01)
The gene for human apolipoprotein E (apo-E) was selected from a library of cloned genomic DNA by screening with a specific cDNA hybridization probe, and its structure was characterized. The complete nucleotide sequence of the gene as well as 856
Barbara Castella et al.
Nature communications, 8, 15663-15663 (2017-06-06)
Vγ9Vδ2 T cells are activated by phosphoantigens, such as isopentenyl pyrophosphate (IPP), which is generated in the mevalonate pathway of antigen-presenting cells. IPP is released in the extracellular microenvironment via unknown mechanisms. Here we show that the ATP-binding cassette transporter

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique