AV48684
Anti-MAP3K1 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-MAPKKK1, Anti-MEKK, Anti-MEKK1, Anti-Mitogen-activated protein kinase kinase kinase 1
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
164 kDa
Espèces réactives
rabbit, guinea pig, rat, mouse, bovine, horse, human, dog
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... MAP3K1(4214)
Catégories apparentées
Description générale
Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin (MAP3K1) is a serine/threonine kinase that regulates cell signaling. It interacts with Axin1 and is involved in Wnt signaling. Genetic variations in MAP3K1 have been linked to breast cancer risk and sex development disorders.
Rabbit Anti-MAP3K1 antibody recognizes human, mouse, rat, bovine, and rabbit MAP3K1.
Rabbit Anti-MAP3K1 antibody recognizes human, mouse, rat, bovine, and rabbit MAP3K1.
Immunogène
Synthetic peptide directed towards the C terminal region of human MAP3K1
Application
Rabbit Anti-MAP3K1 antibody is suitable for western blot applications at a concentration of 1μg/ml.
Actions biochimiques/physiologiques
MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-983 AC008937.7 118022-119004 c 984-1536 AF042838.1 426-978 1537-1653 AC008937.7 68621-68737 c 1654-1802 AC008937.7 68100-68248 c 1803-2870 AF042838.1 1245-2312 2871-4167 AC008937.7 51211-52507 c 4168-4758 BU194120.1 127-717 4759-5154 DA889202.1 164-559 5155-7355 AC008937.7 38082-40282 c 7356-7522 AA602425.1 1-167 c
Séquence
Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Alexander Pearlman et al.
American journal of human genetics, 87(6), 898-904 (2010-12-07)
Investigations of humans with disorders of sex development (DSDs) resulted in the discovery of many of the now-known mammalian sex-determining genes, including SRY, RSPO1, SOX9, NR5A1, WT1, NR0B1, and WNT4. Here, the locus for an autosomal sex-determining gene was mapped
Lilian Jara et al.
Breast cancer research and treatment, 137(2), 559-569 (2012-12-12)
Genome-Wide Association Studies have identified several loci associated with breast cancer (BC) in populations of different ethnic origins. One of the strongest associations was found in the FGFR2 gene, and MAP3K1 has been proposed as a low-penetrance BC risk factor.
Ser Sue Ng et al.
Biological chemistry, 391(2-3), 171-180 (2010-02-05)
A central point of regulation in the Wnt/beta-catenin signalling pathway is the formation of the beta-catenin destruction complex. Axin1, an essential negative regulator of Wnt signalling, serves as a scaffold within this complex and is critical for rapid turnover of
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique