Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV46227

Sigma-Aldrich

Anti-NCAPH antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-BRRN1, Anti-CAP-H, Anti-HCAP-H, Anti-Non-SMC condensin I complex, subunit H

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

82 kDa

Espèces réactives

dog, human, mouse, rabbit, rat, pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_056156

Numéro d'accès UniProt

Q15003

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NCAPH(23397)

Immunogène

Synthetic peptide directed towards the C terminal region of human NCAPH

Application

Anti-NCAPH antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Actions biochimiques/physiologiques

NCAPH (Non-SMC condensin I complex, subunit H) also referred to as HCAP-H, BRRN1 or CAPH belongs to barr gene family and is a regulatory subunit of the condensin complex. It facilitates the conversion of interphase chromatin into mitotic-like condense chromosomes. Caspase-3 gets stimulated and cleaves Cap-H, a subunit of condensin I during prolonged mitotic arrest. This leads to a loss of condensin I complex at the chromosomes and alters the chromosomal integrity. Subsequently DNA fragmentation occurs by caspase-activated Dnase (CAD) that drives the cell towards mitotic death. Additionally, it facilitates for the structural integrity of centromeric heterochromatin during mitosis.

Séquence

Synthetic peptide located within the following region: TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Raquel A Oliveira et al.
Molecular and cellular biology, 25(20), 8971-8984 (2005-10-04)
During cell division, chromatin undergoes structural changes essential to ensure faithful segregation of the genome. Condensins, abundant components of mitotic chromosomes, are known to form two different complexes, condensins I and II. To further examine the role of condensin I
S-K Lai et al.
Cell death and differentiation, 18(6), 996-1004 (2010-12-15)
Mitotic death is a major form of cell death in cancer cells that have been treated with chemotherapeutic drugs. However, the mechanisms underlying this form of cell death is poorly understood. Here, we report that the loss of chromosome integrity

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique