AV43285

Anti-DTX2 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-Deltex homolog 2 (Drosophila), Anti-KIAA1528, Anti-MGC71098, Anti-RNF58
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 62 kDa
• Espèces réactives: goat, bovine, dog, human, rat, horse, mouse, guinea pig, rabbit
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_065943
• Numéro d'accès UniProt: Q6XM87
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... DTX2(113878)

Description

Immunogène

Synthetic peptide directed towards the C terminal region of human DTX2

Actions biochimiques/physiologiques

DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Séquence

Synthetic peptide located within the following region: EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable