AV37504
Anti-MKL1 antibody produced in rabbit
IgG fraction of antiserum
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
IgG fraction of antiserum
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
106 kDa
Espèces réactives
rat, mouse, human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
mouse ... MKL1(223701)
Description générale
Megakaryoblastic Leukemia-1 (MKL1, MAL, MRTF-A, BSAC) is a MRTF family transcription factor with evolutionary conserved domains required for actin-binding, homo- and heterodimerization, high-order chromatin organization and transcriptional activation. MKL1 regulates a wide range of cell processes including epithelial-mesenchymal transition (EMT); megakaryocytic differentiation and migration; neuronal network remodeling; cellular motile functions and muscle cell differentiation including cardiovascular development. It is a component of the Rho/megakaryoblastic leukemia 1 (MKL1) signaling pathway.
Spécificité
Anti-MKL1 polyclonal antibody reacts with bovine, chicken, mouse, human, and rat megakaryoblastic leukemia-1 proteins.
Immunogène
Synthetic peptide directed towards the C terminal of human MKL1
Application
Anti-MKL1 polyclonal antibody is used to tag megakaryoblastic leukemia-1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of megakaryoblastic leukemia-1 in the Rho/megakaryoblastic leukemia 1 (MKL1) signaling pathway and a variety of cell processes such as cell mobilization and the epithelial-mesenchymal transition (EMT).
Actions biochimiques/physiologiques
MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells
Séquence
Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Rabea Hinkel et al.
Nature communications, 5, 3970-3970 (2014-06-10)
Gradual occlusion of coronary arteries may result in reversible loss of cardiomyocyte function (hibernating myocardium), which is amenable to therapeutic neovascularization. The role of myocardin-related transcription factors (MRTFs) co-activating serum response factor (SRF) in this process is largely unknown. Here
Maria Carmela Filomena et al.
eLife, 10 (2021-09-25)
Myopalladin (MYPN) is a striated muscle-specific immunoglobulin domain-containing protein located in the sarcomeric Z-line and I-band. MYPN gene mutations are causative for dilated (DCM), hypertrophic, and restrictive cardiomyopathy. In a yeast two-hybrid screening, MYPN was found to bind to titin
Charly Jehanno et al.
Biochimica et biophysica acta. Gene regulatory mechanisms, 1863(5), 194507-194507 (2020-03-03)
Estrogen receptor (ERα) is central in driving the development of hormone-dependent breast cancers. A major challenge in treating these cancers is to understand and overcome endocrine resistance. The Megakaryoblastic Leukemia 1 (MKL1, MRTFA) protein is a master regulator of actin
Anne T Bertrand et al.
Journal of cell science, 127(Pt 13), 2873-2884 (2014-05-09)
The mechanisms underlying the cell response to mechanical forces are crucial for muscle development and functionality. We aim to determine whether mutations of the LMNA gene (which encodes lamin A/C) causing congenital muscular dystrophy impair the ability of muscle precursors
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique