Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV32135

Sigma-Aldrich

Anti-MyF6 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-MRF4, Anti-Myogenic factor 6 (herculin)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

27 kDa

Espèces réactives

mouse, guinea pig, sheep, rabbit, horse, rat, goat, bovine, dog, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_002460

Numéro d'accès UniProt

P23409

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... MYF6(4618)

Description générale

MyF6 is a possible helix-loop-helix protein that may be involved in muscle differentiation. It is known to have conserved DNA binding and dimerization domains.
Rabbit Anti-MyF6 antibody recognizes canine, human, mouse, rat, bovine, zebrafish, pig, and chicken MyF6.

Immunogène

Synthetic peptide directed towards the N terminal region of human MYF6

Application

Rabbit Anti-MyF6 antibody can be used for western blot applications at a concentration of 1μg/ml.

Actions biochimiques/physiologiques

MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.

Séquence

Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

T Braun et al.
Nucleic acids research, 19(20), 5645-5651 (1991-10-25)
The muscle regulatory proteins Myf3, Myf4, Myf5, and Myf6 share a highly conserved DNA binding and dimerization domain consisting of a cluster of basic amino acids and a potential helix-loop-helix structure. Here we demonstrate that the four human muscle-specific HLH

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique