Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV31860

Sigma-Aldrich

Anti-MyCBP antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-c-Myc binding protein

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

12 kDa

Espèces réactives

guinea pig, human, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MYCBP(26292)

Description générale

Rabbit polyclonal anti-MyCBP antibody reacts with human, mouse, rat, chicken, bovine, and canine c-Myc binding proteins.
c-Myc binding protein (MyCBP/AMY-1) binds the N-terminal region of myc and stimulates E box-dependent transcription of myc. MYCBP is up-regulated in colon carcinoma cells. MyCBP/AMY-1 is a trigger for erythrocyte differentiation. AMY-1 works as an inducer of human K562 cell differentiation upon induction of AraC.

Immunogène

Synthetic peptide directed towards the middle region of human MYCBP

Application

Rabbit Anti-EHF antibody can be used for western blot applications at a dilution of 1.25μg/ml. The product can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.
Rabbit polyclonal anti-MyCBP antibody is used to tag c-Myc binding protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of c-myc binding protein in the regulation of myc expression and erythrocyte differentiation.

Actions biochimiques/physiologiques

The MYCBP gene encodes a protein that binds to the N-terminal region of MYC and stimulates the activation of E box-dependent transcription by MYC.

Séquence

Synthetic peptide located within the following region: AATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique