AMAB90687

Monoclonal Anti-GDF15 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL0328, purified immunoglobulin, buffered aqueous glycerol solution

• Synonyme(s) : MIC-1, NAG-1, PDF, PLAB, PTGFB
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: CL0328, monoclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: RNAi knockdown; Learn more about Antibody Enhanced Validation
• Technique(s): immunofluorescence: 2-10 μg/mL (Fixation/Permeabilization: PFA/Triton X-100); immunohistochemistry: 1:200- 1:500; western blot: 1 μg/mL
• Isotype: IgG1
• Numéro d'accès Ensembl | humain: ENSG00000130513
• Numéro d'accès UniProt: Q99988
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... GDF15(9518)

Description

Description générale

GDF15 (growth and differentiation factor 15), a bona fide heart‐derived hormone, is also referred as macrophage inhibitory cytokine 1 (Mic-1). It belongs to the transforming growth factor beta (TGFβ) superfamily of cytokines. MIC-1, an extracellularly localized secretory protein, is highly expressed in placenta, adult prostate and skin. It is expressed at a relatively less level in other tissues like colon, kidney and fetal brain. GDF15 is located on human chromosome 19p13.11.

Immunogène

Recombinant protein corresponding to Growth differentiation factor 15.

Sequence
LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL

Epitope
Binds to an epitope located within the peptide sequence NQSWEDSNTD as determined by overlapping synthetic peptides.

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

GDF15 (growth and differentiation factor 15) may be involved in macrophage activation. It stimulates the progression of tumors in vivo. GDF15 controls body growth and plays a local cardioprotective role because of its autocrine/paracrine function. It modulates liver growth hormone (GH) signalling.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST72494

Forme physique

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable