Skip to Content
Merck
All Photos(4)

Key Documents

WH0003340M1

Sigma-Aldrich

Monoclonal Anti-NDST1 antibody produced in mouse

clone 1G10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-HSST, Anti-N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1, Anti-NST1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1G10, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NDST1(3340)

General description

NDST1 (N-deacetylase and N-sulfotransferase 1) is a bifunctional enzyme that has both N-deacetylase and N-sulfotransferase activities. This gene is located on human chromosome 5q33.

Immunogen

NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI

Biochem/physiol Actions

The enzyme coded by NDST1 (N-deacetylase and N-sulfotransferase 1) gene participates in the first step in the production of heparan sulfate chains and proteoglycans. This enzyme also plays a major role in generating the GlcNS (N-sulfo glucosamine) residues.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

WT1 mutation and 11P15 loss of heterozygosity predict relapse in very low-risk wilms tumors treated with surgery alone: a children's oncology group study
Perlman EJ, et al.
Journal of Clinical Oncology, 29(6), 698-703 (2011)
Role of Deacetylase Activity of N-Deacetylase/N-Sulfotransferase 1 in Forming N-Sulfated Domain in Heparan Sulfate
Dou W, et al.
The Journal of Biological Chemistry, 290(33), 20427-20437 (2015)
A girl with developmental delay, ataxia, cranial nerve palsies, severe respiratory problems in infancy-Expanding NDST1 syndrome
Armstrong L, et al.
American Journal of Medical Genetics. Part A (2017)

Articles

Glycosaminoglycans are large linear polysaccharides constructed of repeating disaccharide units.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service