Skip to Content
Merck
All Photos(9)

Key Documents

HPA014589

Sigma-Aldrich

Anti-TOMM70 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

KIAA0719, TOM70, TOMM70A

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
conjugate:
unconjugated
application:
IF
IHC
clone:
polyclonal
species reactivity:
mouse, human
citations:
10
technique(s):
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TOMM70A(9868)

General description

TOMM70A (translocase of outer mitochondrial membrane 70 homolog A) is a human ortholog of Tom70 protein found in yeast. This gene maps to human chromosome 3q13.1-q13.2, spans ~37kb, and consists of 12 exons. The encoded protein has a ubiquitous expression pattern in humans. It is a component of the mitochondrial TOM (translocase of outer membrane) complex, which also includes import pore complex and Tom20. It contains one TPR (tetratricopeptide repeat) clamp domain in its cytoplasmic region, and belongs to the TPR co-chaperone family.

Immunogen

translocase of outer mitochondrial membrane 70 recombinant protein epitope signature tag (PrEST)

Application

Anti-TOMM70A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

TOMM70A (translocase of outer mitochondrial membrane 70 homolog A) forms a part of the mitochondrial TOM (translocase of outer membrane) complex, where it prefers preproteins with internal targeting sequences which are hydrophobic in nature. The TPR (tetratricopeptide repeat) domain of this protein docks the C-termius EEVD motifs of Hsp70 and Hsp90 chaperone proteins, and forms a multi-chaperone complex which binds to preproteins, and prevents their aggregation. The expression of this protein is induced by non-structural protein (NS) 3 protein of hepatitis C virus (HCV). TOMM70A is therefore, associated with the apoptotic response to HCV. It interacts with IRF3 protein, and causes apoptosis in the presence of Sendai virus. It also acts as an import receptor for PTEN induced kinase 1 (PINK1), a gene associated with Parkinson′s disease (PD).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72919

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Hiroki Kato et al.
PloS one, 8(3), e58435-e58435 (2013-03-09)
PTEN induced kinase 1 (PINK1) is a serine/threonine kinase in the outer membrane of mitochondria (OMM), and known as a responsible gene of Parkinson's disease (PD). The precursor of PINK1 is synthesized in the cytosol and then imported into the
Angela M Edmonson et al.
Cell communication & adhesion, 9(1), 15-27 (2002-08-31)
Functional mitochondria require up to 1000 proteins to function properly, with 99% synthesized as precursors in the cytoplasm and transported into the mitochondria with the aid of cytosolic chaperones and mitochondrial translocators (import components). Proteins to be imported are chaperoned
Giulia Bertolin et al.
Autophagy, 9(11), 1801-1817 (2013-10-24)
Loss-of-function mutations in PARK2/PARKIN and PINK1 cause early-onset autosomal recessive Parkinson disease (PD). The cytosolic E3 ubiquitin-protein ligase PARK2 cooperates with the mitochondrial kinase PINK1 to maintain mitochondrial quality. A loss of mitochondrial transmembrane potential (ΔΨ) leads to the PINK1-dependent
Lisandra M Gava et al.
Archives of biochemistry and biophysics, 513(2), 119-125 (2011-07-26)
A large majority of the 1000-1500 proteins in the mitochondria are encoded by the nuclear genome, and therefore, they are translated in the cytosol in the form and contain signals to enable the import of proteins into the organelle. The
Takashi Takano et al.
Journal of medical virology, 83(5), 801-809 (2011-03-18)
The localization of hepatitis C virus (HCV) proteins in cells leads to several problems. The translocase of outer mitochondrial membrane 70 (TOM70) is a mitochondrial import receptor. In this study, TOM70 expression was induced by HCV infection. TOM70 overexpression induced

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service