Saltar al contenido
Merck

WH0200576M1

Sigma-Aldrich

Monoclonal Anti-PIP5K3 antibody produced in mouse

clone 6C7, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-CFD, Anti-KIAA0981, Anti-MGC40423, Anti-PIKfyve, Anti-PIP5K, Anti-p235, Anti-phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño


Seleccione un Tamaño

Cambiar Vistas

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

6C7, monoclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

ELISA: suitable
capture ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Descripción general

PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM

Inmunógeno

PIP5K3 (NP_689884, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR

Acciones bioquímicas o fisiológicas

Phosphatidylinositol-3-phosphate/phosphatidylinositol-5-kinase, type III (PIP5K3) is involved in the synthesis of phosphatidylinositol 3, 5-bisphosphate. It also possesses a protein kinase activity. PIP5K3 regulates specific signaling pathways as well as membrane trafficking. Mutations in the gene encoding it are associated with fleck corneal dystrophy.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Producto relacionado

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

nwg

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Andreas Kotoulas et al.
Molecular vision, 17, 2776-2781 (2011-11-09)
To report the findings of the clinical and molecular evaluation in a Greek family with fleck corneal dystrophy (CFD). A 58-year-old woman was seen on routine ophthalmic examination and diagnosed as having CFD. All available family members were examined to
Diego Sbrissa et al.
American journal of physiology. Cell physiology, 303(4), C436-C446 (2012-05-25)
PIKfyve is an essential mammalian lipid kinase with pleiotropic cellular functions whose genetic knockout in mice leads to preimplantation lethality. Despite several reports for PIKfyve-catalyzed synthesis of phosphatidylinositol 5-phosphate (PtdIns5P) along with phosphatidylinositol-3,5-biphosphate [PtdIns(3,5)P(2)] in vitro and in vivo, the

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico