Saltar al contenido
Merck
Todas las fotos(2)

Key Documents

WH0117156M1

Sigma-Aldrich

Monoclonal Anti-SCGB3A2 antibody produced in mouse

clone 1B2, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-LU103, Anti-PNSP1, Anti-UGRP1, Anti-secretoglobin, family 3A, member 2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1B2, monoclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

BC024232

Nº de acceso UniProt

Q96PL1

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SCGB3A2(117156)

Descripción general

In addition to regulating thyroid-specific expression of genes, thyroid transcription factor (TITF1; MIM 600635) controls the transcription of genes specifically expressed in lung, such as surfactant proteins (e.g., SFTPA1; MIM 178630) and uteroglobin (UGB; MIM 192020). Mice lacking Ttf1 die immediately after birth from respiratory failure caused by profoundly hypoplastic lungs (Kimura et al., 1996 [PubMed 8557195]). The UGRP1 gene encodes a uteroglobin-related protein and is a downstream target of TITF1.[supplied by OMIM

Inmunógeno

SCGB3A2 (AAH24232, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

nwg

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Geyon L Garcia et al.
The American journal of pathology, 190(3), 543-553 (2019-12-24)
Chronic obstructive pulmonary disease (COPD) and asthma remain prevalent human lung diseases. Variability in epithelial and inflammatory components that results in pathologic heterogeneity complicates the development of treatments for these diseases. Early childhood infection with parainfluenza virus or respiratory syncytial
Maria R Stupnikov et al.
eLife, 8 (2019-10-22)
Notch signaling regulates cell fate selection during development in multiple organs including the lung. Previous studies on the role of Notch in the lung focused mostly on Notch pathway core components or receptor-specific functions. It is unclear, however, how Jagged
Benjamin J van Soldt et al.
Development (Cambridge, England), 146(9) (2019-04-05)
Although the Hippo-yes-associated protein (Yap) pathway has been implicated in lung development, the specific roles for Yap and its nucleocytoplasmic shuttling in the developing airway and alveolar compartments remain elusive. Moreover, conflicting results from expression studies and differences in the

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico