Saltar al contenido
Merck
Todas las fotos(4)

Key Documents

WH0057761M3

Sigma-Aldrich

Monoclonal Anti-TRIB3 antibody produced in mouse

clone 1H2, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-C20orf97, Anti-NIPK, Anti-SINK, Anti-SKIP3, Anti-TRB3, Anti-tribbles homolog 3 (Drosophila)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(4)

About This Item

Número MDL:
MFCD08705525
Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1H2, monoclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG1κ

Nº de acceso GenBank

BC027484

Nº de acceso UniProt

Q96RU7

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TRIB3(57761)

Descripción general

The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. (provided by RefSeq)

Inmunógeno

TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

nwg

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Pan Zhu et al.
Cell death & disease, 8(12), 3207-3207 (2017-12-15)
The Helicobacter pylori vacuolating cytotoxin (VacA) can promote progressive vacuolation and gastric injury and may be associated with human gastric cancer. Increasing evidence indicates that autophagy is involved in the cell death induced by VacA, but the specific mechanisms need
Michaela D Filiou et al.
Journal of psychiatric research, 58, 115-122 (2014-08-16)
No comprehensive metabolic profile of trait anxiety is to date available. To identify metabolic biosignatures for different anxiety states, we compared mice selectively inbred for ∼ 40 generations for high (HAB), normal (NAB) or low (LAB) anxiety-related behavior. Using a
Devora Champa et al.
Endocrine-related cancer, 21(5), 755-767 (2014-07-12)
Poorly differentiated tumors of the thyroid gland (PDTC) are generally characterized by a poor prognosis due to their resistance to available therapeutic approaches. The relative rarity of these tumors is a major obstacle to our understanding of the molecular mechanisms
Weiwei Wang et al.
Diabetes research and clinical practice, 106(1), 101-109 (2014-08-13)
Fibrosis is the final disorder of most chronic kidney disease including diabetic nephropathy (DN), but the mechanisms are not fully understood. The present study aims to determine whether TRB3 participates in fibrogenesis in DN. Type1 diabetes was induced in male
Gisela Campos et al.
Archives of toxicology, 88(6), 1267-1280 (2014-04-22)
Since xenobiotics enter the organism via the liver, hepatocytes must cope with numerous perturbations, including modifications of proteins leading to endoplasmic reticulum stress (ER-stress). This triggers a signaling pathway termed unfolded protein response (UPR) that aims to restore homeostasis or

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico