Saltar al contenido
Merck
Todas las fotos(2)

Documentos

WH0057526M4

Sigma-Aldrich

Monoclonal Anti-PCDH19 antibody produced in mouse

clone 2G10, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-DKFZp686P1843, Anti-KIAA1313, Anti-protocadherin 19

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.43

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

2G10, monoclonal

formulario

buffered aqueous solution

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

NM_020766

Nº de acceso UniProt

Q8TAB3

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PCDH19(57526)

Descripción general

Protocadherin 19 (PCDH19) is part of the d-protocadherin superfamily. It is expressed in the brain. The gene encoding this calcium-dependent cell adhesion protein is localized on human chromosome Xq22.1.

Inmunógeno

PCDH19 (NP_065817, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR

Acciones bioquímicas o fisiológicas

Protocadherin 19 (PCDH19) has been associated with female-specific epilepsy and an X-linked model of neurological disease. It has a role in neuronal organization and migration. PCDH19 is also involved in cell-cell and cell-matrix adhesion.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

nwg

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

The clinical spectrum of female epilepsy patients with PCDH19 mutations in a Chinese population
A. Liu
Clinical Genetics, 91(1) (2017)
Smith Moyra
Unravelling Complexities In Genetics And Genomics: Impact On Diagnosis Counseling And Management (2016)
Characterizing PCDH19 in human induced pluripotent stem cells (iPSCs) and iPSC-derived developing neurons: emerging role of a protein involved in controlling polarity during neurogenesis
Claudia Compagnucci
Oncotarget, 6(29), 26804-26813 (2015)
Male patients affected by mosaic PCDH19 mutations: five new cases
I.M. de Lange
Neurogenetics (2017)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico