WH0054815M1

Monoclonal Anti-GATAD2A antibody produced in mouse

clone 3F3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-FLJ20085, Anti-GATA zinc finger domain containing 2A, Anti-p66alpha
• Código UNSPSC: 12352203
• NACRES: NA.43

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3F3, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso GenBank: NM_017660
• Nº de acceso UniProt: Q86YP4
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... GATAD2A(54815)

Descripción

Descripción general

GATAD2A (GATA zinc finger domain containing 2A), a 68kDa protein, is a component of multi-subunit protein Mi-2/NuRD (Nucleosome Remodeling Deacetylase) complex. The Mi-2/NuRD complex is essential for the ATP-dependent chromatin remodeling and histone deacetylase activities. It also performs in the methylation dependent transcriptional repression by guiding repressors to the chromatin. The gene encoding GATAD2A is localized on human chromosome 19p13.11. GATAD2A interacts with the histone tail in vitro and acetylates histone tails.

Inmunógeno

GATAD2A (NP_060130, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVP

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): nwg
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)