WH0010146M1

Monoclonal Anti-G3BP antibody produced in mouse

clone 2F3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-HDHVIII, Anti-Ras-GTPase-activating protein SH3-domain-binding protein
• Número MDL: MFCD02262927
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2F3, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: ELISA: suitable; capture ELISA: suitable; immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso GenBank: BC006997
• Nº de acceso UniProt: Q13283
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... G3BP1(10146)

Descripción

Descripción general

G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) is a constituent of stress granules. It is located on human chromosome 5q14.2-5q33.3.

Inmunógeno

G3BP (AAH06997, 214 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRV

Acciones bioquímicas o fisiológicas

G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) blocks the replication of HIV-1 (human immunodeficiency virus) in macrophages and T-cells. In gastric cancer patients, overexpression of G3BP1 leads to imperfect clinical predictions. It is crucial for the interactions of SG–PB (stress granule-processing bodies).

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)