WH0009833M1

Monoclonal Anti-MELK antibody produced in mouse

clone 4D8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-HPK38, Anti-KIAA0175, Anti-maternal embryonic leucine zipper kinase
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 4D8, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgG1κ
• Nº de acceso GenBank: BC014039
• Nº de acceso UniProt: Q14680
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MELK(9833)

Descripción

Descripción general

The maternal embryonic leucine zipper kinase (MELK) is a member of the CAMK serine/threonine protein kinase superfamily. It is expressed at high level in oocytes, spermatogonia and embryos. This gene is mapped to human chromosome 9p13.

Inmunógeno

MELK (AAH14039, 550 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK

Acciones bioquímicas o fisiológicas

The maternal embryonic leucine zipper kinase (MELK) prevents HIV-1 (human immunodeficiency virus) replication. It participates in cell cycle, cytokinesis, mRNA splicing and apoptosis. MELK also plays an important role in the development of germ cells.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)