Saltar al contenido
Merck
Todas las fotos(11)

Documentos clave

WH0009804M1

Sigma-Aldrich

Monoclonal Anti-TOMM20 antibody produced in mouse

clone 4F3, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-KIAA0016, Anti-MAS20, Anti-MGC117367, Anti-MOM19, Anti-TOM20, Anti-translocase of outer mitochondrial membrane 20 homolog (yeast)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

4F3, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human, mouse, rat

técnicas

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG1κ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TOMM20(9804)

Descripción general

Translocase of outer mitochondrial membrane 20 (TOMM20) is a 20kb gene with five exons and four introns, and is mapped to human chromosome 1q42.3. This gene codes for a TOMM20 receptor, which is a subunit of the outer mitochondrial membrane translocase. TOMM20 receptor contains a membrane anchor domain and a cytosolic domain, and is predominantly expressed in human cochlea.

Inmunógeno

TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Acciones bioquímicas o fisiológicas

Translocase of outer mitochondrial membrane 20 (TOMM20) is a subunit of multiple component- dynamic complex, which plays a vital role in importing certain cytosolic proteins into or through the outer membrane of the mitochondria. It acts as a receptor for precursor proteins containing N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factor 2(NRF-2) plays an essential role in regulating transcription of the human TOMM20 gene. TOMM20 has potential as a prognostic biomarker and therapeutic target for gastric cancer. TOMM20 serve as a marker for mitochondrial protein import in inner ear, and reduced expression of TOMM20 is associated with Meniere′s disease.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Opcional

Referencia del producto
Descripción
Precios

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Motohisa Tada et al.
Cancer science, 101(5), 1261-1269 (2010-03-25)
We sought to identify genomic changes that could be useful for clinical application, focusing on chromosomal instability and using a high-density single nucleotide polymorphism (SNP) array. We analyzed 34 gastric cancer cell lines for areas of DNA that exhibited copy
Sinem K Saka et al.
Nature communications, 5, 3664-3664 (2014-04-11)
The isotopic composition of different materials can be imaged by secondary ion mass spectrometry. In biology, this method is mainly used to study cellular metabolism and turnover, by pulsing the cells with marker molecules such as amino acids labelled with
Sebastián A Riquelme et al.
European journal of immunology, 45(12), 3269-3288 (2015-10-16)
Heme-oxygenase 1 (HO-1) prevents T cell-mediated inflammatory disease by producing carbon monoxide (CO) and impairing DC immunogenicity. However, the cellular mechanisms causing this inhibition are unknown. Here, we show that CO impairs mitochondrial function in DCs by reducing both the
José R Blesa et al.
Gene, 391(1-2), 198-208 (2007-02-16)
TOMM20 is a subunit of the outer mitochondrial membrane translocase that plays a major role as a receptor of precursor proteins with N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factors 1 and 2 (NRF-1 and NRF-2) play an
E Schleiff et al.
Biochemistry, 37(38), 13052-13058 (1998-09-28)
hTom20 is an outer mitochondrial membrane receptor involved in protein translocation. The cytosolic domain (aa30-145) and selected truncated versions of this domain were overexpressed and purified to study the structure-function relationship of this protein. Our studies reveal that the secondary

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico