WH0008795M1

Monoclonal Anti-TNFRSF10B antibody produced in mouse

clone 2D6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-DR5, Anti-KILLER, Anti-KILLER/DR5, Anti-TRAILR2, Anti-TRICK2, Anti-TRICK2A, Anti-TRICK2B, Anti-TRICKB, Anti-ZTNFR9, Anti-tumor necrosis factor receptor superfamily, member 10b
• Número MDL: MFCD01865566
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2D6, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso GenBank: BC001281
• Nº de acceso UniProt: O14763
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TNFRSF10B(8795)

Descripción

Descripción general

The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. (provided by RefSeq)

Inmunógeno

TNFRSF10B (AAH01281, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDC

Acciones bioquímicas o fisiológicas

The gene TNFRSF10B (TNF receptor superfamily member 10b) is a tumor suppressor gene, which upon mutation, leads to a loss of chromosome p arm, a common occurrence in head and neck tumors. It inhibits tumorigenesis via apoptosis. The cytoplasmic death domain (DD) of the protein employs fas-associated death domain (FADD) and caspases to form the death-inducing signal complex (DISC) when the receptor is trimerized. This leads to activation of caspases and cell death.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)