WH0007465M1

Monoclonal Anti-WEE1 antibody produced in mouse

clone 5B6, ascites fluid

• Sinónimos: Anti-DKFZp686I18166, Anti-WEE1 homolog (S. pombe), Anti-WEE1hu
• Número MDL: MFCD02100120
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: ascites fluid
• tipo de anticuerpo: primary antibodies
• clon: 5B6, monoclonal
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1:500-1:1000
• isotipo: IgMκ
• Nº de acceso GenBank: NM_003390
• Nº de acceso UniProt: P30291
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... WEE1(7465)

Descripción

Descripción general

This gene encodes a nuclear protein, which is a tyrosine kinase belonging to the Ser/Thr family of protein kinases. This protein catalyzes the inhibitory tyrosine phosphorylation of CDC2/cyclin B kinase, and appears to coordinate the transition between DNA replication and mitosis by protecting the nucleus from cytoplasmically activated CDC2 kinase. (provided by RefSeq)

Inmunógeno

WEE1 (NP_003381, 289 a.a. ~ 388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAI

Forma física

Solution

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)