Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

WH0006279M1

Sigma-Aldrich

Monoclonal Anti-S100A8 antibody produced in mouse

clone 2H2, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-60B8AG, Anti-CAGA, Anti-CFAG, Anti-CGLA, Anti-CP10, Anti-L1Ag, Anti-MA387, Anti-MIF, Anti-MRP8, Anti-NIF, Anti-P8, Anti-S100 calcium binding protein A8 (calgranulin A)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.43
conjugado:
unconjugated
application:
ELISA (i)
WB
clon:
2H2, monoclonal
reactividad de especies:
human
citations:
3
técnicas:
indirect ELISA: suitable
western blot: 1-5 μg/mL

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

2H2, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... S100A8(6279)

Descripción general

The gene S100A8 (S100 calcium-binding protein A8) is mapped to human chromosome 1q21. It is also known as myeloid-related protein 8 (MRP8) or calgranulin A. It is a small calcium-binding protein, which is strongly expressed in neutrophils. In presence of cell stimulation, it is also expressed in monocytes, macrophages, platelets and epithelial and endothelial cells. S100A8 protein is present as a homodimer as well as heterodimer. The protein has two EF-hand motifs and one high-affinity Ca2+ binding site.

Inmunógeno

S100A8 (AAH05928.1, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Acciones bioquímicas o fisiológicas

S100A8 (S100 calcium-binding protein A8) is mainly present at the inflammation site or in the serum during acute and chronic inflammation. It is responsible for neutrophil recruitment, attachment and release from the bone marrow. S100A8 is crucial for sending neutrophils to the site of inflammation in the presence of bacterial infection, lipopolysaccharide and monosodium urate crystals. The protein is also involved in granulocyte and monocyte attachment to endothelium and also their transport across endothelial cells. The S100A8/A9 heterodimer induces monocyte migration and cytokine secretion. In the presence of falciparum malaria, high levels of S100A8 are present in the blood.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Secretion of S100A8, S100A9, and S100A12 by Neutrophils Involves Reactive Oxygen Species and Potassium Efflux.
Tardif MR
Journal of immunology research (2015)
Additive effect of the AZGP1, PIP, S100A8 and UBE2C molecular biomarkers improves outcome prediction in breast carcinoma.
Parris TZ
International Journal of Cancer. Journal International Du Cancer (2014)
mRNA Expression of S100A8 as a Prognostic Marker for Progression of Non-Muscle-Invasive Bladder Cancer.
Ha YS
Korean Journal of Urology (2010)
Comparative proteomic analysis reveals activation of mucosal innate immune signaling pathways during cholera.
Ellis CN
Infection and Immunity (2015)
Up-regulated S100 calcium binding protein A8 in Plasmodium-infected patients correlates with CD4(+)CD25(+)Foxp3 regulatory T cell generation.
Malaria Journal (2015)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico