WH0005223M1

Monoclonal Anti-PGAM1 antibody produced in mouse

clone 2G1-A6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-PGAMA, Anti-phosphoglycerate mutase 1 (brain)
• Código UNSPSC: 12352203
• NACRES: NA.41
• clon: 2G1-A6, monoclonal
• application: ELISA (i); WB
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• citations: 5

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2G1-A6, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso GenBank: BC011678
• Nº de acceso UniProt: P18669
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PGAM1(5223)

Descripción

Descripción general

Phosphoglycerate mutase 1 (PGAM1) is an important glycolytic enzyme. This gene is located on human chromosome 10q24.

Inmunógeno

PGAM1 (AAH11678.1, 1 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

Aplicación

Monoclonal Anti-PGAM1 antibody has been used in western blotting.

Acciones bioquímicas o fisiológicas

Phosphoglycerate mutase 1 (PGAM1) participates in glycolysis, pentose phosphate pathway and serine biosynthesis in cancer cells. It helps to convert 3-phosphoglycerate (3-PG) into 2-PG in glycolysis. PGAM1 is essential to support glycolysis for normal cell activities.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)