WH0004638M1

Monoclonal Anti-MYLK antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-DKFZp686I10125, Anti-FLJ12216, Anti-KRP, Anti-MLCK, Anti-MLCK108, Anti-MLCK210, Anti-myosin, light polypeptide kinase
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1D1, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso GenBank: NM_053025
• Nº de acceso UniProt: Q15746
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MYLK(4638)

Descripción

Descripción general

This gene, a muscle member of the immunoglobulin gene superfamily, encodes myosin light chain kinase which is a calcium/calmodulin dependent enzyme. This kinase phosphorylates myosin regulatory light chains to facilitate myosin interaction with actin filaments to produce contractile activity. This gene encodes both smooth muscle and nonmuscle isoforms. In addition, using a separate promoter in an intron in the 3′ region, it encodes telokin, a small protein identical in sequence to the C-terminus of myosin light chain kinase, that is independently expressed in smooth muscle and functions to stabilize unphosphorylated myosin filaments. A pseudogene is located on the p arm of chromosome 3. Four transcript variants that produce four isoforms of the calcium/calmodulin dependent enzyme have been identified as well as two transcripts that produce two isoforms of telokin. Additional variants have been identified but lack full length transcripts. (provided by RefSeq)

Inmunógeno

MYLK (NP_444253, 1710 a.a. ~ 1809 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKP

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)