WH0003925M1

Monoclonal Anti-STMN1 antibody produced in mouse

clone 3A9, ascites fluid

• Sinónimos: Anti-LAP18, Anti-Lag, Anti-OP18, Anti-PP17, Anti-PP19, Anti-PR22, Anti-SMN, Anti-stathmin 1/oncoprotein 18
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: ascites fluid
• tipo de anticuerpo: primary antibodies
• clon: 3A9, monoclonal
• reactividad de especies: human
• técnicas: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1:500-1:1000
• isotipo: IgMκ
• Nº de acceso GenBank: BC014353
• Nº de acceso UniProt: P16949
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... STMN1(3925)

Descripción

Descripción general

This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Inmunógeno

STMN1 (AAH14353, 40 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Forma física

Solution

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)