WH0002940M1

Monoclonal Anti-GSTA3 antibody produced in mouse

clone 1F11, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-GSTA33, Anti-GTA3, Anti-MGC22232, Anti-glutathione S-transferase A3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1F11, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso GenBank: BC020619
• Nº de acceso UniProt: Q16772
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... GSTA3(2940)

Descripción

Descripción general

Glutathione S-transferase alpha 3 (GSTA3) has two isoforms, that is cytosolic and membrane-bound, which are encoded by two distinct supergene families. These enzymes are involved in cellular defence against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyses the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. (provided by RefSeq)GSTA3 is a adipocyte differentiation-associated protein. It is expressed in steroidogenic tissues. The protein belongs to the family of detoxifying and cytoprotective enzymes.

Inmunógeno

GSTA3 (AAH20619, 1 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

Acciones bioquímicas o fisiológicas

Glutathione S-transferase alpha 3 (GSTA3) is involved in the metabolism of electrophilic xenobiotic and endobiotic toxic compounds. It may be used as a target for prescribing medication in steroid hormone-dependent diseases. This protein is related to diseases associated with oxidation-regulating proteins. It is used as a therapeutic target for renal interstitial fibrosis (RIF).

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)