WH0002322M1

Monoclonal Anti-FLT3 antibody produced in mouse

clone 1A11, ascites fluid

• Sinónimos: Anti-CD135, Anti-FLK2, Anti-STK1, Anti-fms-related tyrosine kinase 3
• Número MDL: MFCD01633120
• Código UNSPSC: 12352203

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: ascites fluid
• tipo de anticuerpo: primary antibodies
• clon: 1A11, monoclonal
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso GenBank: NM_004119
• Nº de acceso UniProt: P36888
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... FLT3(2322)

Descripción

Descripción general

This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. The receptor consists of an extracellular domain composed of five immunoglobulin-like domains, one transmembrane region, and a cytoplasmic kinase domain split into two parts by a kinase-insert domain. The receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia. (provided by RefSeq)

Inmunógeno

FLT3 (NP_004110, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP

Forma física

Solution

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)