WH0002303M2

Monoclonal Anti-FOXC2 antibody produced in mouse

clone 2H3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-FKHL14, Anti-MFH1, Anti-forkhead box C2 (MFH-1, mesenchyme forkhead 1)
• Número MDL: MFCD06411812
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2H3, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: mouse, human, rat
• técnicas: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2bλ
• Nº de acceso GenBank: NM_005251
• Nº de acceso UniProt: Q99958
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... FOXC2(2303)

Descripción

Descripción general

Forkhead Box Protein C2 (FOXC2) is a transcription factor. It belongs to the forkhead/winged-helix family of transcription factors. This gene is located on human chromosome 16q24.

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. (provided by RefSeq)

Inmunógeno

FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY

Aplicación

Monoclonal Anti-FOXC2 antibody has been used in immunohistochemistry.

Acciones bioquímicas o fisiológicas

Forkhead Box Protein C2 (FOXC2) controls YAP (yes-associated protein) signaling and stimulates the progression of nasopharyngeal carcinoma by promoting glycolysis. It plays a major role in inducing invasion and metastasis. Mutations in FOXC2 result in hereditary Lymphedema-Distichiasis syndrome.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)