WH0001486M1

Monoclonal Anti-CTBS antibody produced in mouse

clone 1B5-1B9, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-CTB, Anti-chitobiase, di-N-acetyl-
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1B5-1B9, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso GenBank: BC024007
• Nº de acceso UniProt: Q01459
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CTBS(1486)

Descripción

Descripción general

The gene CTBS (chitobiase) is mapped to human chromosome 1p22. The gene spans a length of approximately 20kb with seven exons interspaced by six introns. The 5′-flanking region of human chitobiase gene is rich in GC-content.

Inmunógeno

CTBS (AAH24007.2, 37 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL

Acciones bioquímicas o fisiológicas

The gene CTBS (chitobiase) encodes a lysosomal glycosidase that functions in the degradation of asparagine-linked glycoproteins. It cleaves the reducing-end N-Acetylglucosamine residues from the chitobiose core of oligosaccharides.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)