SAB5702648

Anti-Annexin A5/Annexin V Antibody, clone 9A5M8, Rabbit Monoclonal

• Sinónimos: ANX5, ENX2, HEL-S-7, PP4, RPRGL3
• Código UNSPSC: 12352203
• NACRES: NA.46
• clon: 9A5M8, monoclonal
• application: WB
• reactividad de especies: human, rat, rat
• técnicas: western blot: 1:500 - 1:2000

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 9A5M8, monoclonal
• Formulario: liquid
• mol peso: 36 kDa
• reactividad de especies: human, rat, rat
• concentración: 0.5 mg/mL
• técnicas: western blot: 1:500 - 1:2000
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: IEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• Nº de acceso UniProt: P08758
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ANXA5(308)

Descripción

Descripción general

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008]

Inmunógeno

A synthetic peptide corresponding to a sequence within amino acids 221-320 of human Annexin A5/Annexin A5/Annexin V (P08758).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicación

WB

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1