SAB5702597

Anti-HSPA2 Antibody, clone 5C9X0, Rabbit Monoclonal

• Sinónimos: HSP70-2, HSP70-3
• Código UNSPSC: 12352203
• NACRES: NA.46

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• Materiales: colorless
• clon: 5C9X0, monoclonal
• formulario: liquid
• mol peso: 70 kDa
• reactividad de especies: rat, rat, human
• concentración: 1.85 mg/mL
• técnicas: immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• color: colorless
• isotipo: IgG
• secuencia del inmunógeno: ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE
• Nº de acceso UniProt: P54652
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HSPA2(3306)

Descripción

Descripción general

Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release. Plays a role in spermatogenesis. In association with SHCBP1L may participate in the maintenance of spindle integrity during meiosis in male germ cells (By similarity.

Inmunógeno

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 488-637 of human HSPA2 (P54652).

Aplicación

WB, IF/ICC

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1